Lineage for d4ef8b1 (4ef8 B:1-312)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2091323Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2091324Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2091728Protein automated matches [190228] (18 species)
    not a true protein
  7. 2091777Species Leishmania major [TaxId:5664] [255853] (6 PDB entries)
  8. 2091779Domain d4ef8b1: 4ef8 B:1-312 [251740]
    Other proteins in same PDB: d4ef8a2, d4ef8b2
    automated match to d3c61a_
    complexed with 0fi, fmn, gol, so4

Details for d4ef8b1

PDB Entry: 4ef8 (more details), 1.56 Å

PDB Description: Crystal structure of dihydroorotate dehydrogenase from Leishmania major in complex with Phenyl isothiocyanate
PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d4ef8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ef8b1 c.1.4.1 (B:1-312) automated matches {Leishmania major [TaxId: 5664]}
mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq
alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate
kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaae
ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr
cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq
tldefrgkvrtl

SCOPe Domain Coordinates for d4ef8b1:

Click to download the PDB-style file with coordinates for d4ef8b1.
(The format of our PDB-style files is described here.)

Timeline for d4ef8b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ef8b2