Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (18 species) not a true protein |
Species Leishmania major [TaxId:5664] [255853] (6 PDB entries) |
Domain d4ef8b1: 4ef8 B:1-312 [251740] Other proteins in same PDB: d4ef8a2, d4ef8b2 automated match to d3c61a_ complexed with 0fi, fmn, gol, so4 |
PDB Entry: 4ef8 (more details), 1.56 Å
SCOPe Domain Sequences for d4ef8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ef8b1 c.1.4.1 (B:1-312) automated matches {Leishmania major [TaxId: 5664]} mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaae ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq tldefrgkvrtl
Timeline for d4ef8b1: