SCOPe 2.04: Domain d4ef8b_: 4ef8 B:

Lineage for d4ef8b_ (4ef8 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (14 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [255853] (6 PDB entries)

8. Domain d4ef8b_: 4ef8 B: [251740]
   automated match to d3c61a_
   complexed with 0fi, fmn, gol, so4

Details for d4ef8b_

PDB Entry: 4ef8, 1.56 Å

PDB Description: Crystal structure of dihydroorotate dehydrogenase from Leishmania major in complex with Phenyl isothiocyanate

PDB Compounds: (B:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d4ef8b_:

Sequence; same for both SEQRES and ATOM records:

>d4ef8b_ c.1.4.1 (B:) automated matches {Leishmania major [TaxId: 5664]}
gsmslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpr
yqalplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaava
tekgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaa
aeilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafy
rrcpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkr
yqtldefrgkvrtl

Timeline for d4ef8b_:

• d4ef8b_ is new in SCOPe 2.04-stable
  
• d4ef8b_ appears in SCOPe 2.05
  
• d4ef8b_ appears in the current release, SCOPe 2.08, called d4ef8b1