Lineage for d1ts2a1 (1ts2 A:1-93)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59002Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 59304Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)
  6. 59390Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 59391Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 59409Domain d1ts2a1: 1ts2 A:1-93 [25174]
    Other proteins in same PDB: d1ts2a2, d1ts2b2, d1ts2c2

Details for d1ts2a1

PDB Entry: 1ts2 (more details), 2.3 Å

PDB Description: t128a mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1ts2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ts2a1 b.40.2.2 (A:1-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d1ts2a1:

Click to download the PDB-style file with coordinates for d1ts2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ts2a1: