![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries) |
![]() | Domain d4ecee_: 4ece E: [251727] automated match to d1ulba_ complexed with gun; mutant |
PDB Entry: 4ece (more details), 2.6 Å
SCOPe Domain Sequences for d4ecee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ecee_ c.56.2.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvpg hagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnpk fevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmge qrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslitn kvimdyeslekanweevlaagkqaaqkleqfvsilmasiplp
Timeline for d4ecee_: