Lineage for d4eceb_ (4ece B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1861402Protein automated matches [190142] (18 species)
    not a true protein
  7. 1861452Species Human (Homo sapiens) [TaxId:9606] [256021] (5 PDB entries)
  8. 1861466Domain d4eceb_: 4ece B: [251724]
    automated match to d1ulba_
    complexed with gun; mutant

Details for d4eceb_

PDB Entry: 4ece (more details), 2.6 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase (W16Y, W94Y, W178Y, H257W) mutant from human complexed with guanine
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4eceb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eceb_ c.56.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprstvpg
hagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaagglnpk
fevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykqmge
qrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfslitn
kvimdyeslekanweevlaagkqaaqkleqfvsilmasiplpd

SCOPe Domain Coordinates for d4eceb_:

Click to download the PDB-style file with coordinates for d4eceb_.
(The format of our PDB-style files is described here.)

Timeline for d4eceb_: