Lineage for d4ec2a_ (4ec2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962266Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2962311Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2962312Family d.82.2.1: Frataxin-like [55388] (3 proteins)
    iron homeostasis proteins
    automatically mapped to Pfam PF01491
  6. 2962313Protein C-terminal domain of frataxin [55389] (2 species)
    protein responsible for Friedreich ataxia
  7. 2962314Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143571] (5 PDB entries)
    Uniprot Q07540 52-174! Uniprot Q07540 61-172
  8. 2962316Domain d4ec2a_: 4ec2 A: [251722]
    automated match to d2ga5a1
    complexed with fe2

Details for d4ec2a_

PDB Entry: 4ec2 (more details), 3 Å

PDB Description: crystal structure of trimeric frataxin from the yeast saccharomyces cerevisiae, complexed with ferrous
PDB Compounds: (A:) Frataxin homolog, mitochondrial

SCOPe Domain Sequences for d4ec2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ec2a_ d.82.2.1 (A:) C-terminal domain of frataxin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vpqevlnlplekaheeaddyldhlldsleelseahpdcipdvelshgvmtleipafgtyv
inkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekaisk

SCOPe Domain Coordinates for d4ec2a_:

Click to download the PDB-style file with coordinates for d4ec2a_.
(The format of our PDB-style files is described here.)

Timeline for d4ec2a_: