SCOPe 2.08: Domain d4eb8b1: 4eb8 B:1-286

Lineage for d4eb8b1 (4eb8 B:1-286)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256021] (7 PDB entries)

8. Domain d4eb8b1: 4eb8 B:1-286 [251720]
   Other proteins in same PDB: d4eb8a2, d4eb8b2
   automated match to d1ulba_
   complexed with edo, im5, po4; mutant

Details for d4eb8b1

PDB Entry: 4eb8, 2.3 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase (W16Y, W94Y, W178Y, H257W) mutant from human complexed with DADMe-ImmG and phosphate

PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4eb8b1:

Sequence; same for both SEQRES and ATOM records:

>d4eb8b1 c.56.2.1 (B:1-286) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstykq
mgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itnkvimdyeslekanweevlaagkqaaqkleqfvsilmasiplpd

Timeline for d4eb8b1:

• d4eb8b1 first appeared in SCOPe 2.04, called d4eb8b_
  
• d4eb8b1 appears in SCOPe 2.07