SCOPe 2.04: Domain d4eb8a_: 4eb8 A:

Lineage for d4eb8a_ (4eb8 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256021] (5 PDB entries)

8. Domain d4eb8a_: 4eb8 A: [251719]
   automated match to d1ulba_
   complexed with edo, im5, po4; mutant

Details for d4eb8a_

PDB Entry: 4eb8, 2.3 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase (W16Y, W94Y, W178Y, H257W) mutant from human complexed with DADMe-ImmG and phosphate

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d4eb8a_:

Sequence; same for both SEQRES and ATOM records:

>d4eb8a_ c.56.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tlmengytyedykntaeyllshtkhrpqvaiicgsglggltdkltqaqifdyseipnfpr
stvpghagrlvfgflngracvmmqgrfhmyegyplykvtfpvrvfhllgvdtlvvtnaag
glnpkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralsty
kqmgeqrelqegtyvmvagpsfetvaecrvlqklgadavgmstvpevivarhcglrvfgf
slitnkvimdyeslekanweevlaagkqaaqkleqfvsilmasiplpd

Timeline for d4eb8a_:

• d4eb8a_ is new in SCOPe 2.04-stable
  
• d4eb8a_ appears in SCOPe 2.05
  
• d4eb8a_ appears in the current release, SCOPe 2.08, called d4eb8a1