Lineage for d4e9sa3 (4e9s A:336-517)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1774939Protein multi-copper oxidase CueO [69194] (1 species)
  7. 1774940Species Escherichia coli [TaxId:562] [69195] (29 PDB entries)
  8. 1774943Domain d4e9sa3: 4e9s A:336-517 [251712]
    automated match to d3od3a3
    complexed with act, cu

Details for d4e9sa3

PDB Entry: 4e9s (more details), 1.06 Å

PDB Description: Multicopper Oxidase CueO (data5)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d4e9sa3:

Sequence, based on SEQRES records: (download)

>d4e9sa3 b.6.1.3 (A:336-517) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
vg

Sequence, based on observed residues (ATOM records): (download)

>d4e9sa3 b.6.1.3 (A:336-517) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhhmnhggkfdfhhan
kingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahrag
wkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgftvg

SCOPe Domain Coordinates for d4e9sa3:

Click to download the PDB-style file with coordinates for d4e9sa3.
(The format of our PDB-style files is described here.)

Timeline for d4e9sa3: