![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
![]() | Protein multi-copper oxidase CueO [69194] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [69195] (29 PDB entries) |
![]() | Domain d4e9sa1: 4e9s A:29-170 [251710] automated match to d1kv7a1 complexed with act, cu |
PDB Entry: 4e9s (more details), 1.06 Å
SCOPe Domain Sequences for d4e9sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e9sa1 b.6.1.3 (A:29-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} aerptlpipdllttdarnriqltigagqstfggktattwgyngnllgpavklqrgkavtv diynqlteettlhwhglevpgevdggpqgiippggkrsvtlnvdqpaatcwfhphqhgkt grqvamglaglvvieddeilkl
Timeline for d4e9sa1: