Lineage for d4e9ra3 (4e9r A:336-516)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771385Protein multi-copper oxidase CueO, C-terminal domain [418909] (1 species)
  7. 2771386Species Escherichia coli [TaxId:562] [419323] (38 PDB entries)
  8. 2771389Domain d4e9ra3: 4e9r A:336-516 [251709]
    Other proteins in same PDB: d4e9ra1, d4e9ra2, d4e9ra4
    automated match to d3od3a3
    complexed with act, cu

    has additional insertions and/or extensions that are not grouped together

Details for d4e9ra3

PDB Entry: 4e9r (more details), 1.3 Å

PDB Description: Multicopper Oxidase CueO (data4)
PDB Compounds: (A:) Blue copper oxidase cueO

SCOPe Domain Sequences for d4e9ra3:

Sequence, based on SEQRES records: (download)

>d4e9ra3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhsqmmghmghgnmnh
mnhggkfdfhhankingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfril
sengkppaahragwkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgft
v

Sequence, based on observed residues (ATOM records): (download)

>d4e9ra3 b.6.1.3 (A:336-516) multi-copper oxidase CueO, C-terminal domain {Escherichia coli [TaxId: 562]}
slpalpslegltvrklqlsmdpmldmmgmqmlmekygdqamagmdhhmnhggkfdfhhan
kingqafdmnkpmfaaakgqyerwvisgvgdmmlhpfhihgtqfrilsengkppaahrag
wkdtvkvegnvsevlvkfnhdapkehaymahchllehedtgmmlgftv

SCOPe Domain Coordinates for d4e9ra3:

Click to download the PDB-style file with coordinates for d4e9ra3.
(The format of our PDB-style files is described here.)

Timeline for d4e9ra3: