Lineage for d4e9ox_ (4e9o X:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (14 species)
    not a true protein
  7. 2402421Species Vaccinia virus [TaxId:10245] [256246] (5 PDB entries)
  8. 2402422Domain d4e9ox_: 4e9o X: [251703]
    automated match to d1dmya_
    complexed with iod

Details for d4e9ox_

PDB Entry: 4e9o (more details), 1.42 Å

PDB Description: Vaccinia D8L ectodomain structure
PDB Compounds: (X:) IMV membrane protein

SCOPe Domain Sequences for d4e9ox_:

Sequence, based on SEQRES records: (download)

>d4e9ox_ b.74.1.0 (X:) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslsnhegkphyitenyrnpyklnddtevyys

Sequence, based on observed residues (ATOM records): (download)

>d4e9ox_ b.74.1.0 (X:) automated matches {Vaccinia virus [TaxId: 10245]}
pqqlspinietkkaisnarlkpldihyneskpttiqntgklvrinfkggyisggflpney
vlsslhiywgkeddygsnhlidvykysgeinlvhwnkkkyssyeeakkhddgliiisifl
qvldhknvyfqkivnqldsirsantsapfdsvfyldnllpskldyftylgttinhsadav
wiifptpinihsdqlskfrtllslsgkphyitenyrnpyklnddtevyys

SCOPe Domain Coordinates for d4e9ox_:

Click to download the PDB-style file with coordinates for d4e9ox_.
(The format of our PDB-style files is described here.)

Timeline for d4e9ox_: