Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (14 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [256245] (1 PDB entry) |
Domain d4e98b_: 4e98 B: [251699] automated match to d3ah6d_ complexed with cl |
PDB Entry: 4e98 (more details), 2 Å
SCOPe Domain Sequences for d4e98b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e98b_ d.58.5.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 353152]} iesniiliyisapnqdeatsiaktlvdeelcacvsiipsvrsiykfkgqvhdenevmllv kttsqlfttlkekvteihsyelpeiiatkvvygnenyinwvnqtvr
Timeline for d4e98b_: