SCOPe 2.05: Domain d4e98b_: 4e98 B:

Lineage for d4e98b_ (4e98 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.0: automated matches [191474] (1 protein)
   not a true family

6. Protein automated matches [190753] (14 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [256245] (1 PDB entry)

8. Domain d4e98b_: 4e98 B: [251699]
   automated match to d3ah6d_
   complexed with cl

Details for d4e98b_

PDB Entry: 4e98, 2 Å

PDB Description: crystal structure of possible cuta1 divalent ion tolerance protein from cryptosporidium parvum iowa ii

PDB Compounds: (B:) CutA1 divalent ion tolerance protein

SCOPe Domain Sequences for d4e98b_:

Sequence; same for both SEQRES and ATOM records:

>d4e98b_ d.58.5.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
iesniiliyisapnqdeatsiaktlvdeelcacvsiipsvrsiykfkgqvhdenevmllv
kttsqlfttlkekvteihsyelpeiiatkvvygnenyinwvnqtvr

Timeline for d4e98b_:

• d4e98b_ first appeared in SCOPe 2.04
  
• d4e98b_ appears in SCOPe 2.06
  
• d4e98b_ appears in the current release, SCOPe 2.08