Lineage for d4e98a_ (4e98 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2950563Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 2950865Family d.58.5.0: automated matches [191474] (1 protein)
    not a true family
  6. 2950866Protein automated matches [190753] (21 species)
    not a true protein
  7. 2950942Species Cryptosporidium parvum [TaxId:353152] [256245] (1 PDB entry)
  8. 2950943Domain d4e98a_: 4e98 A: [251698]
    automated match to d3ah6d_
    complexed with cl

Details for d4e98a_

PDB Entry: 4e98 (more details), 2 Å

PDB Description: crystal structure of possible cuta1 divalent ion tolerance protein from cryptosporidium parvum iowa ii
PDB Compounds: (A:) CutA1 divalent ion tolerance protein

SCOPe Domain Sequences for d4e98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e98a_ d.58.5.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
tetkiesniiliyisapnqdeatsiaktlvdeelcacvsiipsvrsiykfkgqvhdenev
mllvkttsqlfttlkekvteihsyelpeiiatkvvygnenyinwvnqtvr

SCOPe Domain Coordinates for d4e98a_:

Click to download the PDB-style file with coordinates for d4e98a_.
(The format of our PDB-style files is described here.)

Timeline for d4e98a_: