SCOPe 2.05: Domain d4e5jc_: 4e5j C:

Lineage for d4e5jc_ (4e5j C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza A virus [TaxId:93838] [254808] (15 PDB entries)

8. Domain d4e5jc_: 4e5j C: [251687]
   automated match to d3ebja_
   complexed with 581, mn, so4

Details for d4e5jc_

PDB Entry: 4e5j, 2.35 Å

PDB Description: crystal structure of avian influenza virus pan bound to compound 5

PDB Compounds: (C:) Polymerase protein PA

SCOPe Domain Sequences for d4e5jc_:

Sequence; same for both SEQRES and ATOM records:

>d4e5jc_ c.52.1.34 (C:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
e

Timeline for d4e5jc_:

• d4e5jc_ first appeared in SCOPe 2.04
  
• d4e5jc_ appears in SCOPe 2.06
  
• d4e5jc_ appears in the current release, SCOPe 2.08