Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) |
Family c.52.1.34: PA N-terminal domain [254166] (2 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
Protein PA N-terminal domain [254375] (5 species) |
Species Influenza A virus [TaxId:93838] [254808] (15 PDB entries) |
Domain d4e5jc_: 4e5j C: [251687] automated match to d3ebja_ complexed with 581, mn, so4 |
PDB Entry: 4e5j (more details), 2.35 Å
SCOPe Domain Sequences for d4e5jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e5jc_ c.52.1.34 (C:) PA N-terminal domain {Influenza A virus [TaxId: 93838]} medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa e
Timeline for d4e5jc_: