Lineage for d1aw7d1 (1aw7 D:601-693)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 229053Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)
  7. 229054Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)
  8. 229062Domain d1aw7d1: 1aw7 D:601-693 [25167]
    Other proteins in same PDB: d1aw7a2, d1aw7b2, d1aw7c2, d1aw7d2
    mutant

Details for d1aw7d1

PDB Entry: 1aw7 (more details), 1.95 Å

PDB Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1aw7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw7d1 b.40.2.2 (D:601-693) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

SCOP Domain Coordinates for d1aw7d1:

Click to download the PDB-style file with coordinates for d1aw7d1.
(The format of our PDB-style files is described here.)

Timeline for d1aw7d1: