Lineage for d4e4vb1 (4e4v B:70-497)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2725423Family a.118.1.1: Armadillo repeat [48372] (7 proteins)
    this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain
  6. 2725546Protein automated matches [190070] (4 species)
    not a true protein
  7. 2725558Species Human (Homo sapiens) [TaxId:9606] [187211] (13 PDB entries)
  8. 2725568Domain d4e4vb1: 4e4v B:70-497 [251664]
    Other proteins in same PDB: d4e4va2, d4e4vb2
    automated match to d1q1sc_
    complexed with dtt, gol

Details for d4e4vb1

PDB Entry: 4e4v (more details), 2.53 Å

PDB Description: the crystal structure of the dimeric human importin alpha 1 at 2.5 angstrom resolution.
PDB Compounds: (B:) Importin subunit alpha-2

SCOPe Domain Sequences for d4e4vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e4vb1 a.118.1.1 (B:70-497) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsflg
rtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni
agdgsvfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappidav
eqilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpi
vtpalraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdq
iqqvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnll
takdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvyrasl
sliekyfs

SCOPe Domain Coordinates for d4e4vb1:

Click to download the PDB-style file with coordinates for d4e4vb1.
(The format of our PDB-style files is described here.)

Timeline for d4e4vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e4vb2