![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.1: Armadillo repeat [48372] (7 proteins) this is a repeat family; one repeat unit is 1ee4 A:288-330 found in domain |
![]() | Protein automated matches [190070] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187211] (13 PDB entries) |
![]() | Domain d4e4vb1: 4e4v B:70-497 [251664] Other proteins in same PDB: d4e4va2, d4e4vb2 automated match to d1q1sc_ complexed with dtt, gol |
PDB Entry: 4e4v (more details), 2.53 Å
SCOPe Domain Sequences for d4e4vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e4vb1 a.118.1.1 (B:70-497) automated matches {Human (Homo sapiens) [TaxId: 9606]} nqgtvnwsvddivkginssnvenqlqatqaarkllsrekqppidniiraglipkfvsflg rtdcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgni agdgsvfrdlvikygavdpllallavpdmsslacgylrnltwtlsnlcrnknpappidav eqilptlvrllhhddpevladtcwaisyltdgpnerigmvvktgvvpqlvkllgaselpi vtpalraignivtgtdeqtqvvidagalavfpslltnpktniqkeatwtmsnitagrqdq iqqvvnhglvpflvsvlskadfktqkeavwavtnytsggtveqivylvhcgiieplmnll takdtkiilvildaisnifqaaeklgeteklsimieecggldkiealqnhenesvyrasl sliekyfs
Timeline for d4e4vb1: