SCOP 1.55: Domain d1aw7c1: 1aw7 C:401-493

Lineage for d1aw7c1 (1aw7 C:401-493)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50225] (11 PDB entries)

8. Domain d1aw7c1: 1aw7 C:401-493 [25166]
   Other proteins in same PDB: d1aw7a2, d1aw7b2, d1aw7c2, d1aw7d2

Details for d1aw7c1

PDB Entry: 1aw7, 1.95 Å

PDB Description: q136a mutant of toxic shock syndrome toxin-1 from s. aureus

SCOP Domain Sequences for d1aw7c1:

Sequence; same for both SEQRES and ATOM records:

>d1aw7c1 b.40.2.2 (C:401-493) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus}
stndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkge
kvdlntkrtkksqhtsegtyihfqisgvtntek

Timeline for d1aw7c1:

• d1aw7c1 appears in SCOP 1.57
  
• d1aw7c1 appears in the current release, SCOPe 2.08