Lineage for d4e3sa2 (4e3s A:376-903)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571252Protein Family B DNA polymerase [56680] (7 species)
  7. 2571253Species Bacteriophage RB69 [TaxId:12353] [56681] (93 PDB entries)
  8. 2571288Domain d4e3sa2: 4e3s A:376-903 [251652]
    Other proteins in same PDB: d4e3sa1
    automated match to d3qeta2
    protein/DNA complex; complexed with ca, qtp

Details for d4e3sa2

PDB Entry: 4e3s (more details), 2.04 Å

PDB Description: RB69 DNA Polymerase Ternary Complex with dQTP Opposite dT
PDB Compounds: (A:) DNA polymerase

SCOPe Domain Sequences for d4e3sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e3sa2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkalinglagalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOPe Domain Coordinates for d4e3sa2:

Click to download the PDB-style file with coordinates for d4e3sa2.
(The format of our PDB-style files is described here.)

Timeline for d4e3sa2: