SCOPe 2.08: Domain d4e0ic_: 4e0i C:

Lineage for d4e0ic_ (4e0i C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.0: automated matches [191449] (1 protein)
   not a true family

6. Protein automated matches [190684] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries)

8. Domain d4e0ic_: 4e0i C: [251645]
   automated match to d3w4yb_
   complexed with fad; mutant

Details for d4e0ic_

PDB Entry: 4e0i, 3 Å

PDB Description: Crystal structure of the C30S/C133S mutant of Erv1 from Saccharomyces cerevisiae

PDB Compounds: (C:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d4e0ic_:

Sequence; same for both SEQRES and ATOM records:

>d4e0ic_ a.24.15.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
elmpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypc
nwsakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

Timeline for d4e0ic_:

• d4e0ic_ first appeared in SCOPe 2.04
  
• d4e0ic_ appears in SCOPe 2.07