![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) ![]() |
![]() | Family a.24.15.0: automated matches [191449] (1 protein) not a true family |
![]() | Protein automated matches [190684] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries) |
![]() | Domain d4e0ib_: 4e0i B: [251644] automated match to d3w4yb_ complexed with fad; mutant |
PDB Entry: 4e0i (more details), 3 Å
SCOPe Domain Sequences for d4e0ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e0ib_ a.24.15.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} selmpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiyp cnwsakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd
Timeline for d4e0ib_: