Lineage for d4e0ib_ (4e0i B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312098Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2312130Family a.24.15.0: automated matches [191449] (1 protein)
    not a true family
  6. 2312131Protein automated matches [190684] (3 species)
    not a true protein
  7. 2312135Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [194765] (3 PDB entries)
  8. 2312140Domain d4e0ib_: 4e0i B: [251644]
    automated match to d3w4yb_
    complexed with fad; mutant

Details for d4e0ib_

PDB Entry: 4e0i (more details), 3 Å

PDB Description: Crystal structure of the C30S/C133S mutant of Erv1 from Saccharomyces cerevisiae
PDB Compounds: (B:) Mitochondrial FAD-linked sulfhydryl oxidase ERV1

SCOPe Domain Sequences for d4e0ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e0ib_ a.24.15.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
selmpgsrtyrkvdppdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiyp
cnwsakdfekyirenapqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd

SCOPe Domain Coordinates for d4e0ib_:

Click to download the PDB-style file with coordinates for d4e0ib_.
(The format of our PDB-style files is described here.)

Timeline for d4e0ib_: