Lineage for d4e00a2 (4e00 A:186-374)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973930Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2973931Protein Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) [69805] (1 species)
  7. 2973932Species Norway rat (Rattus norvegicus) [TaxId:10116] [69806] (15 PDB entries)
  8. 2973935Domain d4e00a2: 4e00 A:186-374 [251639]
    Other proteins in same PDB: d4e00a1
    automated match to d3tz0a2
    complexed with 0f1, adp, k, mg

Details for d4e00a2

PDB Entry: 4e00 (more details), 2.15 Å

PDB Description: Crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/3,6-dichlorobenzo[b]thiophene-2-carboxylic acid complex with ADP
PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4e00a2:

Sequence, based on SEQRES records: (download)

>d4e00a2 d.122.1.4 (A:186-374) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhid

Sequence, based on observed residues (ATOM records): (download)

>d4e00a2 d.122.1.4 (A:186-374) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhid

SCOPe Domain Coordinates for d4e00a2:

Click to download the PDB-style file with coordinates for d4e00a2.
(The format of our PDB-style files is described here.)

Timeline for d4e00a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4e00a1