SCOPe 2.04: Domain d4e00a1: 4e00 A:39-185

Lineage for d4e00a1 (4e00 A:39-185)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.0: automated matches [230678] (1 protein)
   not a true family

6. Protein automated matches [230679] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [233753] (12 PDB entries)

8. Domain d4e00a1: 4e00 A:39-185 [251638]
   Other proteins in same PDB: d4e00a2
   automated match to d3tz0a1
   complexed with 0f1, adp, k, mg

Details for d4e00a1

PDB Entry: 4e00, 2.15 Å

PDB Description: Crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/3,6-dichlorobenzo[b]thiophene-2-carboxylic acid complex with ADP

PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d4e00a1:

Sequence; same for both SEQRES and ATOM records:

>d4e00a1 a.29.5.0 (A:39-185) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rltptmmlysgrsqdgshllksgrylqqelpvriahrikgfrslpfiigcnptilhvhel
yirafqkltdfppikdqadeaqycqlvrqllddhkdvvtllaeglresrkhiedeklvry
fldktltsrlgirmlathhlalhedkp

Timeline for d4e00a1:

• d4e00a1 is new in SCOPe 2.04-stable
  
• d4e00a1 appears in SCOPe 2.05
  
• d4e00a1 appears in the current release, SCOPe 2.08