Lineage for d4dywb_ (4dyw B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971823Species Burkholderia pseudomallei [TaxId:320372] [256243] (1 PDB entry)
  8. 2971825Domain d4dywb_: 4dyw B: [251634]
    automated match to d3hhja_

Details for d4dywb_

PDB Entry: 4dyw (more details), 2.5 Å

PDB Description: Crystal structure of MutT NUDIX hydrolase from Burkholderia pseudomallei
PDB Compounds: (B:) MutT/nudix family protein

SCOPe Domain Sequences for d4dywb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dywb_ d.113.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
eqprvgcgaaivrdgrillikrkrapeagcwglpggkvdwlepveravcreieeelgial
eratllcvvdhidaangehwvapvylahafsgeprvvepdrhealgwfalddlpqpltha
trialeqvt

SCOPe Domain Coordinates for d4dywb_:

Click to download the PDB-style file with coordinates for d4dywb_.
(The format of our PDB-style files is described here.)

Timeline for d4dywb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4dywa_