| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
| Protein automated matches [191036] (17 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [256243] (1 PDB entry) |
| Domain d4dywb_: 4dyw B: [251634] automated match to d3hhja_ |
PDB Entry: 4dyw (more details), 2.5 Å
SCOPe Domain Sequences for d4dywb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4dywb_ d.113.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
eqprvgcgaaivrdgrillikrkrapeagcwglpggkvdwlepveravcreieeelgial
eratllcvvdhidaangehwvapvylahafsgeprvvepdrhealgwfalddlpqpltha
trialeqvt
Timeline for d4dywb_: