SCOPe 2.04: Domain d4dyea1: 4dye A:0-120

Lineage for d4dyea1 (4dye A:0-120)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [256241] (1 PDB entry)

8. Domain d4dyea1: 4dye A:0-120 [251628]
   Other proteins in same PDB: d4dyea2
   automated match to d2oqha1
   complexed with edo, gol

Details for d4dyea1

PDB Entry: 4dye, 1.6 Å

PDB Description: crystal structure of an enolase (putative sugar isomerase, target efi- 502095) from streptomyces coelicolor, no mg, ordered loop

PDB Compounds: (A:) isomerase

SCOPe Domain Sequences for d4dyea1:

Sequence; same for both SEQRES and ATOM records:

>d4dyea1 d.54.1.0 (A:0-120) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mmkitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivr
rmapdligtspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllg
g

Timeline for d4dyea1:

• d4dyea1 is new in SCOPe 2.04-stable
  
• d4dyea1 appears in SCOPe 2.05
  
• d4dyea1 appears in the current release, SCOPe 2.08