Lineage for d4dyea1 (4dye A:1-120)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2515158Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2515159Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2515455Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2515456Protein automated matches [226922] (88 species)
    not a true protein
  7. 2516133Species Streptomyces coelicolor [TaxId:1902] [256241] (1 PDB entry)
  8. 2516134Domain d4dyea1: 4dye A:1-120 [251628]
    Other proteins in same PDB: d4dyea2, d4dyea3
    automated match to d2oqha1
    complexed with edo, gol

Details for d4dyea1

PDB Entry: 4dye (more details), 1.6 Å

PDB Description: crystal structure of an enolase (putative sugar isomerase, target efi- 502095) from streptomyces coelicolor, no mg, ordered loop
PDB Compounds: (A:) isomerase

SCOPe Domain Sequences for d4dyea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dyea1 d.54.1.0 (A:1-120) automated matches {Streptomyces coelicolor [TaxId: 1902]}
mkitdvdvwvvnlplvnpftssfetktgetrtvvrvrtdsgvegwgetmwgapvaaivrr
mapdligtspfaleafhrkqhmvpffygylgyaaiaavdvacwdamgkatgqsvtdllgg

SCOPe Domain Coordinates for d4dyea1:

Click to download the PDB-style file with coordinates for d4dyea1.
(The format of our PDB-style files is described here.)

Timeline for d4dyea1: