SCOPe 2.06: Domain d4dw6a1: 4dw6 A:24-93

Lineage for d4dw6a1 (4dw6 A:24-93)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (22 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)

8. Domain d4dw6a1: 4dw6 A:24-93 [251626]
   Other proteins in same PDB: d4dw6a2
   automated match to d3sfia1
   protein/DNA complex; complexed with 0mn, gol, nh4

Details for d4dw6a1

PDB Entry: 4dw6, 2 Å

PDB Description: Novel N-phenyl-phenoxyacetamide derivatives as potential EthR inhibitors and ethionamide boosters. Discovery and optimization using High-Throughput Synthesis.

PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4dw6a1:

Sequence; same for both SEQRES and ATOM records:

>d4dw6a1 a.4.1.0 (A:24-93) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaen

Timeline for d4dw6a1:

• d4dw6a1 first appeared in SCOPe 2.04
  
• d4dw6a1 appears in SCOPe 2.05
  
• d4dw6a1 appears in SCOPe 2.07
  
• d4dw6a1 appears in the current release, SCOPe 2.08