Lineage for d4dw6a1 (4dw6 A:24-93)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692824Species Mycobacterium tuberculosis [TaxId:1773] [232223] (13 PDB entries)
  8. 2692833Domain d4dw6a1: 4dw6 A:24-93 [251626]
    Other proteins in same PDB: d4dw6a2
    automated match to d3sfia1
    protein/DNA complex; complexed with 0mn, gol, nh4

Details for d4dw6a1

PDB Entry: 4dw6 (more details), 2 Å

PDB Description: Novel N-phenyl-phenoxyacetamide derivatives as potential EthR inhibitors and ethionamide boosters. Discovery and optimization using High-Throughput Synthesis.
PDB Compounds: (A:) HTH-type transcriptional regulator EthR

SCOPe Domain Sequences for d4dw6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dw6a1 a.4.1.0 (A:24-93) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
drelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvnqa
dmalqtlaen

SCOPe Domain Coordinates for d4dw6a1:

Click to download the PDB-style file with coordinates for d4dw6a1.
(The format of our PDB-style files is described here.)

Timeline for d4dw6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dw6a2