![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d4duxd4: 4dux D:626-730 [251624] Other proteins in same PDB: d4duxa1, d4duxa3, d4duxa5, d4duxb1, d4duxb3, d4duxb5, d4duxc1, d4duxc3, d4duxc5, d4duxd1, d4duxd3, d4duxd5 automated match to d1jz8a2 complexed with 0mk, dms, mg, na |
PDB Entry: 4dux (more details), 2.3 Å
SCOPe Domain Sequences for d4duxd4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duxd4 b.1.4.0 (D:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d4duxd4:
![]() Domains from same chain: (mouse over for more information) d4duxd1, d4duxd2, d4duxd3, d4duxd5 |