Lineage for d4duxd1 (4dux D:9-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384768Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2384820Domain d4duxd1: 4dux D:9-219 [251621]
    Other proteins in same PDB: d4duxa2, d4duxa3, d4duxa4, d4duxa5, d4duxb2, d4duxb3, d4duxb4, d4duxb5, d4duxc2, d4duxc3, d4duxc4, d4duxc5, d4duxd2, d4duxd3, d4duxd4, d4duxd5
    automated match to d1f49a3
    complexed with 0mk, dms, mg, na

Details for d4duxd1

PDB Entry: 4dux (more details), 2.3 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with l-ribose
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d4duxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duxd1 b.18.1.0 (D:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d4duxd1:

Click to download the PDB-style file with coordinates for d4duxd1.
(The format of our PDB-style files is described here.)

Timeline for d4duxd1: