![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (125 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
![]() | Domain d4duxc3: 4dux C:334-625 [251618] Other proteins in same PDB: d4duxa1, d4duxa2, d4duxa4, d4duxa5, d4duxb1, d4duxb2, d4duxb4, d4duxb5, d4duxc1, d4duxc2, d4duxc4, d4duxc5, d4duxd1, d4duxd2, d4duxd4, d4duxd5 automated match to d1jz7a5 complexed with 0mk, dms, mg, na |
PDB Entry: 4dux (more details), 2.3 Å
SCOPe Domain Sequences for d4duxc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duxc3 c.1.8.0 (C:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgsesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d4duxc3:
![]() Domains from same chain: (mouse over for more information) d4duxc1, d4duxc2, d4duxc4, d4duxc5 |