Lineage for d4duxb2 (4dux B:220-333)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763012Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2763111Domain d4duxb2: 4dux B:220-333 [251612]
    Other proteins in same PDB: d4duxa1, d4duxa3, d4duxa5, d4duxb1, d4duxb3, d4duxb5, d4duxc1, d4duxc3, d4duxc5, d4duxd1, d4duxd3, d4duxd5
    automated match to d1jz8a1
    complexed with 0mk, dms, mg, na

Details for d4duxb2

PDB Entry: 4dux (more details), 2.3 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with l-ribose
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4duxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duxb2 b.1.4.0 (B:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d4duxb2:

Click to download the PDB-style file with coordinates for d4duxb2.
(The format of our PDB-style files is described here.)

Timeline for d4duxb2: