Lineage for d4duxa5 (4dux A:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782136Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2782185Domain d4duxa5: 4dux A:731-1023 [251610]
    Other proteins in same PDB: d4duxa1, d4duxa2, d4duxa3, d4duxa4, d4duxb1, d4duxb2, d4duxb3, d4duxb4, d4duxc1, d4duxc2, d4duxc3, d4duxc4, d4duxd1, d4duxd2, d4duxd3, d4duxd4
    automated match to d1jz8a4
    complexed with 0mk, dms, mg, na

Details for d4duxa5

PDB Entry: 4dux (more details), 2.3 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460s) in complex with l-ribose
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4duxa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duxa5 b.30.5.0 (A:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d4duxa5:

Click to download the PDB-style file with coordinates for d4duxa5.
(The format of our PDB-style files is described here.)

Timeline for d4duxa5: