| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
| Protein automated matches [190075] (132 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
| Domain d4duxa3: 4dux A:334-625 [251608] Other proteins in same PDB: d4duxa1, d4duxa2, d4duxa4, d4duxa5, d4duxb1, d4duxb2, d4duxb4, d4duxb5, d4duxc1, d4duxc2, d4duxc4, d4duxc5, d4duxd1, d4duxd2, d4duxd4, d4duxd5 automated match to d1jz7a5 complexed with 0mk, dms, mg, na |
PDB Entry: 4dux (more details), 2.3 Å
SCOPe Domain Sequences for d4duxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duxa3 c.1.8.0 (A:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgsesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d4duxa3:
View in 3DDomains from same chain: (mouse over for more information) d4duxa1, d4duxa2, d4duxa4, d4duxa5 |