Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
Domain d4duxa2: 4dux A:220-333 [251607] Other proteins in same PDB: d4duxa1, d4duxa3, d4duxa5, d4duxb1, d4duxb3, d4duxb5, d4duxc1, d4duxc3, d4duxc5, d4duxd1, d4duxd3, d4duxd5 automated match to d1jz8a1 complexed with 0mk, dms, mg, na |
PDB Entry: 4dux (more details), 2.3 Å
SCOPe Domain Sequences for d4duxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duxa2 b.1.4.0 (A:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d4duxa2:
View in 3D Domains from same chain: (mouse over for more information) d4duxa1, d4duxa3, d4duxa4, d4duxa5 |