Lineage for d4duwd3 (4duw D:334-625)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570672Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1570673Protein automated matches [190075] (60 species)
    not a true protein
  7. 1570748Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 1570788Domain d4duwd3: 4duw D:334-625 [251603]
    Other proteins in same PDB: d4duwa1, d4duwa2, d4duwa4, d4duwa5, d4duwb1, d4duwb2, d4duwb4, d4duwb5, d4duwc1, d4duwc2, d4duwc4, d4duwc5, d4duwd1, d4duwd2, d4duwd4, d4duwd5
    automated match to d1jz7a5
    complexed with dms, lak, mg, na

Details for d4duwd3

PDB Entry: 4duw (more details), 2.2 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) in complex with allolactose
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d4duwd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duwd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d4duwd3:

Click to download the PDB-style file with coordinates for d4duwd3.
(The format of our PDB-style files is described here.)

Timeline for d4duwd3: