![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d4duwd2: 4duw D:220-333 [251602] Other proteins in same PDB: d4duwa1, d4duwa3, d4duwa5, d4duwb1, d4duwb3, d4duwb5, d4duwc1, d4duwc3, d4duwc5, d4duwd1, d4duwd3, d4duwd5 automated match to d1jz8a1 complexed with dms, lak, mg, na |
PDB Entry: 4duw (more details), 2.2 Å
SCOPe Domain Sequences for d4duwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duwd2 b.1.4.0 (D:220-333) automated matches {Escherichia coli K-12 [TaxId: 83333]} tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
Timeline for d4duwd2:
![]() Domains from same chain: (mouse over for more information) d4duwd1, d4duwd3, d4duwd4, d4duwd5 |