Lineage for d3tssa1 (3tss A:5-93)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540834Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 1541003Protein Toxic shock syndrome toxin-1 (TSST-1) [50224] (2 species)
  7. 1541004Species Staphylococcus aureus [TaxId:1280] [50225] (12 PDB entries)
  8. 1541005Domain d3tssa1: 3tss A:5-93 [25160]
    Other proteins in same PDB: d3tssa2
    mutant

Details for d3tssa1

PDB Entry: 3tss (more details), 1.9 Å

PDB Description: toxic shock syndrome toxin-1 tetramutant, p2(1) crystal form
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d3tssa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tssa1 b.40.2.2 (A:5-93) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
nikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkgekvdl
ntkrikksqhtsegtwihfqisgvtntek

SCOPe Domain Coordinates for d3tssa1:

Click to download the PDB-style file with coordinates for d3tssa1.
(The format of our PDB-style files is described here.)

Timeline for d3tssa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tssa2