![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
![]() | Protein automated matches [190075] (125 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries) |
![]() | Domain d4duvd3: 4duv D:334-625 [251583] Other proteins in same PDB: d4duva1, d4duva2, d4duva4, d4duva5, d4duva6, d4duvb1, d4duvb2, d4duvb4, d4duvb5, d4duvb6, d4duvc1, d4duvc2, d4duvc4, d4duvc5, d4duvc6, d4duvd1, d4duvd2, d4duvd4, d4duvd5, d4duvd6 automated match to d1jz7a5 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 4duv (more details), 2.1 Å
SCOPe Domain Sequences for d4duvd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duvd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d4duvd3: