![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
![]() | Domain d4duvc5: 4duv C:731-1023 [251580] Other proteins in same PDB: d4duva1, d4duva2, d4duva3, d4duva4, d4duva6, d4duvb1, d4duvb2, d4duvb3, d4duvb4, d4duvb6, d4duvc1, d4duvc2, d4duvc3, d4duvc4, d4duvc6, d4duvd1, d4duvd2, d4duvd3, d4duvd4, d4duvd6 automated match to d1jz8a4 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 4duv (more details), 2.1 Å
SCOPe Domain Sequences for d4duvc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duvc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d4duvc5: