Lineage for d4duvb5 (4duv B:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2782125Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2782126Protein automated matches [226849] (8 species)
    not a true protein
  7. 2782136Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2782162Domain d4duvb5: 4duv B:731-1023 [251575]
    Other proteins in same PDB: d4duva1, d4duva2, d4duva3, d4duva4, d4duva6, d4duvb1, d4duvb2, d4duvb3, d4duvb4, d4duvb6, d4duvc1, d4duvc2, d4duvc3, d4duvc4, d4duvc6, d4duvd1, d4duvd2, d4duvd3, d4duvd4, d4duvd6
    automated match to d1jz8a4
    complexed with 2dg, btb, dms, mg, na

Details for d4duvb5

PDB Entry: 4duv (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) 2-deoxy-galactosyl-enzyme and bis-tris complex
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4duvb5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duvb5 b.30.5.0 (B:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d4duvb5:

Click to download the PDB-style file with coordinates for d4duvb5.
(The format of our PDB-style files is described here.)

Timeline for d4duvb5: