Lineage for d4duvb3 (4duv B:334-625)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441237Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2441267Domain d4duvb3: 4duv B:334-625 [251573]
    Other proteins in same PDB: d4duva1, d4duva2, d4duva4, d4duva5, d4duva6, d4duvb1, d4duvb2, d4duvb4, d4duvb5, d4duvb6, d4duvc1, d4duvc2, d4duvc4, d4duvc5, d4duvc6, d4duvd1, d4duvd2, d4duvd4, d4duvd5, d4duvd6
    automated match to d1jz7a5
    complexed with 2dg, btb, dms, mg, na

Details for d4duvb3

PDB Entry: 4duv (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) 2-deoxy-galactosyl-enzyme and bis-tris complex
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4duvb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duvb3 c.1.8.0 (B:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d4duvb3:

Click to download the PDB-style file with coordinates for d4duvb3.
(The format of our PDB-style files is described here.)

Timeline for d4duvb3: