Lineage for d4duvb1 (4duv B:9-219)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384768Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2384798Domain d4duvb1: 4duv B:9-219 [251571]
    Other proteins in same PDB: d4duva2, d4duva3, d4duva4, d4duva5, d4duva6, d4duvb2, d4duvb3, d4duvb4, d4duvb5, d4duvb6, d4duvc2, d4duvc3, d4duvc4, d4duvc5, d4duvc6, d4duvd2, d4duvd3, d4duvd4, d4duvd5, d4duvd6
    automated match to d1f49a3
    complexed with 2dg, btb, dms, mg, na

Details for d4duvb1

PDB Entry: 4duv (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) 2-deoxy-galactosyl-enzyme and bis-tris complex
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d4duvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duvb1 b.18.1.0 (B:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d4duvb1:

Click to download the PDB-style file with coordinates for d4duvb1.
(The format of our PDB-style files is described here.)

Timeline for d4duvb1: