Lineage for d4duva4 (4duv A:626-730)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2372434Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2372926Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2372927Protein automated matches [254633] (16 species)
    not a true protein
  7. 2373010Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries)
  8. 2373068Domain d4duva4: 4duv A:626-730 [251569]
    Other proteins in same PDB: d4duva1, d4duva3, d4duva5, d4duva6, d4duvb1, d4duvb3, d4duvb5, d4duvb6, d4duvc1, d4duvc3, d4duvc5, d4duvc6, d4duvd1, d4duvd3, d4duvd5, d4duvd6
    automated match to d1jz8a2
    complexed with 2dg, btb, dms, mg, na

Details for d4duva4

PDB Entry: 4duv (more details), 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (g974a) 2-deoxy-galactosyl-enzyme and bis-tris complex
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4duva4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4duva4 b.1.4.0 (A:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOPe Domain Coordinates for d4duva4:

Click to download the PDB-style file with coordinates for d4duva4.
(The format of our PDB-style files is described here.)

Timeline for d4duva4: