![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
![]() | Protein automated matches [254633] (19 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
![]() | Domain d4duva4: 4duv A:626-730 [251569] Other proteins in same PDB: d4duva1, d4duva3, d4duva5, d4duva6, d4duvb1, d4duvb3, d4duvb5, d4duvb6, d4duvc1, d4duvc3, d4duvc5, d4duvc6, d4duvd1, d4duvd3, d4duvd5, d4duvd6 automated match to d1jz8a2 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 4duv (more details), 2.1 Å
SCOPe Domain Sequences for d4duva4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duva4 b.1.4.0 (A:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d4duva4: