| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
| Domain d4duva1: 4duv A:9-219 [251566] Other proteins in same PDB: d4duva2, d4duva3, d4duva4, d4duva5, d4duva6, d4duvb2, d4duvb3, d4duvb4, d4duvb5, d4duvb6, d4duvc2, d4duvc3, d4duvc4, d4duvc5, d4duvc6, d4duvd2, d4duvd3, d4duvd4, d4duvd5, d4duvd6 automated match to d1f49a3 complexed with 2dg, btb, dms, mg, na |
PDB Entry: 4duv (more details), 2.1 Å
SCOPe Domain Sequences for d4duva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4duva1 b.18.1.0 (A:9-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapea
vpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfn
vdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmv
lrwsdgsyledqdmwrmsgifrdvsllhkpt
Timeline for d4duva1: