Lineage for d1se2_1 (1se2 1-120)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 296865Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 297207Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 297238Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)
  7. 297239Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries)
  8. 297246Domain d1se2_1: 1se2 1-120 [25156]
    Other proteins in same PDB: d1se2_2

Details for d1se2_1

PDB Entry: 1se2 (more details), 2.7 Å

PDB Description: staphylococcal enterotoxin c2, monoclinic form

SCOP Domain Sequences for d1se2_1:

Sequence, based on SEQRES records: (download)

>d1se2_1 b.40.2.2 (1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records): (download)

>d1se2_1 b.40.2.2 (1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdntggktcmyggitkheg

SCOP Domain Coordinates for d1se2_1:

Click to download the PDB-style file with coordinates for d1se2_1.
(The format of our PDB-style files is described here.)

Timeline for d1se2_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se2_2