| Class b: All beta proteins [48724] (126 folds) |
| Fold b.40: OB-fold [50198] (9 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) |
| Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species) |
| Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries) |
| Domain d1ste_1: 1ste 1-120 [25154] Other proteins in same PDB: d1ste_2 complexed with zn |
PDB Entry: 1ste (more details), 2 Å
SCOP Domain Sequences for d1ste_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ste_1 b.40.2.2 (1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg
Timeline for d1ste_1: