SCOPe 2.08: Domain d4dr0a_: 4dr0 A:

Lineage for d4dr0a_ (4dr0 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187547] (2 PDB entries)

8. Domain d4dr0a_: 4dr0 A: [251535]
   automated match to d1uzrb_
   complexed with mn, so4

Details for d4dr0a_

PDB Entry: 4dr0, 1.9 Å

PDB Description: crystal structure of bacillus subtilis dimanganese(ii) nrdf

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4dr0a_:

Sequence; same for both SEQRES and ATOM records:

>d4dr0a_ a.25.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mtkiydaanwskheddftqmfynqnvkqfwlpeeialngdlltwkylgkneqdtymkvla
gltlldteqgntgmpivaehvdghqrkavlnfmammenavhaksysnifmtlaptetine
vfewvkqnkylqkkaqmivglykaiqkddeislfkamvasvylesflfysgfyyplyfyg
qgklmqsgeiinlilrdeaihgvyvgllaqeiynkqteekkaelrefaidllnqlyenel
eytedlydqvglshdvkkfirynankalmnlgfdpyfeeedinpivlngl

Timeline for d4dr0a_:

• d4dr0a_ first appeared in SCOPe 2.04
  
• d4dr0a_ appears in SCOPe 2.07