Lineage for d4doua3 (4dou A:386-525)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777632Domain d4doua3: 4dou A:386-525 [251531]
    automated match to d1c3ha_
    complexed with ca, edo, gol, na

Details for d4doua3

PDB Entry: 4dou (more details), 2 Å

PDB Description: crystal structure of a single-chain trimer of human adiponectin globular domain
PDB Compounds: (A:) Adiponectin

SCOPe Domain Sequences for d4doua3:

Sequence, based on SEQRES records: (download)

>d4doua3 b.22.1.0 (A:386-525) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgegayvyrsafsvgletyvtipnmpirftkifynqqnhydgstgkfhcnipglyyfayh
itvymkdvkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvygegerng
lyadndndstftgfllyhdt

Sequence, based on observed residues (ATOM records): (download)

>d4doua3 b.22.1.0 (A:386-525) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pyvyrsafsvgletyipnmpirftkifynqqnhydgstgkfhcnipglyyfayhitvymk
dvkvslfkkdkamlftydqyqennvdqasgsvllhlevgdqvwlqvygegernglyadnd
ndstftgfllyhdt

SCOPe Domain Coordinates for d4doua3:

Click to download the PDB-style file with coordinates for d4doua3.
(The format of our PDB-style files is described here.)

Timeline for d4doua3: